Lineage for d1soga_ (1sog A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002485Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2002486Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (189 PDB entries)
    Uniprot P00431
  8. 2002556Domain d1soga_: 1sog A: [105844]
    complexed with hem, k; mutant

Details for d1soga_

PDB Entry: 1sog (more details), 1.85 Å

PDB Description: Cyrstal Structure of Cytochrome c Peroxidase Mutant: CcPK2M2
PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1soga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1soga_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahtlgkt
hlknsgyegpwtannnvfdnsfylnllnedwklekndanneqwdsksgylqlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d1soga_:

Click to download the PDB-style file with coordinates for d1soga_.
(The format of our PDB-style files is described here.)

Timeline for d1soga_: