Lineage for d1soaa_ (1soa A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481897Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 482002Family c.23.16.2: DJ-1/PfpI [52325] (6 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 482003Protein DJ-1 [89603] (1 species)
    RNA-binding protein regulatory subunit
  7. 482004Species Human (Homo sapiens) [TaxId:9606] [89604] (9 PDB entries)
  8. 482006Domain d1soaa_: 1soa A: [105843]

Details for d1soaa_

PDB Entry: 1soa (more details), 1.2 Å

PDB Description: human dj-1 with sulfinic acid

SCOP Domain Sequences for d1soaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1soaa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens)}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

SCOP Domain Coordinates for d1soaa_:

Click to download the PDB-style file with coordinates for d1soaa_.
(The format of our PDB-style files is described here.)

Timeline for d1soaa_: