SCOP 1.71: Domain d1soaa_: 1soa A:

Lineage for d1soaa_ (1soa A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (7 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein DJ-1 [89603] (1 species)
   RNA-binding protein regulatory subunit

7. Species Human (Homo sapiens) [TaxId:9606] [89604] (9 PDB entries)

8. Domain d1soaa_: 1soa A: [105843]

Details for d1soaa_

PDB Entry: 1soa, 1.2 Å

PDB Description: human dj-1 with sulfinic acid

SCOP Domain Sequences for d1soaa_:

Sequence; same for both SEQRES and ATOM records:

>d1soaa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens)}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

Timeline for d1soaa_:

• d1soaa_ first appeared in SCOP 1.69
  
• d1soaa_ appears in SCOP 1.73
  
• d1soaa_ appears in the current release, SCOPe 2.08