Lineage for d1snrb2 (1snr B:167-339)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457650Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 457651Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 457981Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 458069Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 458107Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (23 PDB entries)
  8. 458111Domain d1snrb2: 1snr B:167-339 [105826]

Details for d1snrb2

PDB Entry: 1snr (more details), 1.31 Å

PDB Description: Nitric oxide bound to Cu nitrite reductase

SCOP Domain Sequences for d1snrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1snrb2 b.6.1.3 (B:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

SCOP Domain Coordinates for d1snrb2:

Click to download the PDB-style file with coordinates for d1snrb2.
(The format of our PDB-style files is described here.)

Timeline for d1snrb2: