![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (6 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
![]() | Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (23 PDB entries) |
![]() | Domain d1snrb1: 1snr B:5-166 [105825] |
PDB Entry: 1snr (more details), 1.31 Å
SCOP Domain Sequences for d1snrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1snrb1 b.6.1.3 (B:5-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6} taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf katkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk
Timeline for d1snrb1:
![]() Domains from other chains: (mouse over for more information) d1snra1, d1snra2, d1snrc1, d1snrc2 |