Lineage for d1sm12_ (1sm1 2:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627824Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 627828Protein 50S subunit [58125] (3 species)
  7. 627866Species Deinococcus radiodurans [TaxId:1299] [69993] (15 PDB entries)
  8. 627960Domain d1sm12_: 1sm1 2: [105726]

Details for d1sm12_

PDB Entry: 1sm1 (more details), 3.42 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with quinupristin and dalfopristin

SCOP Domain Sequences for d1sm12_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm12_ i.1.1.2 (2:) 50S subunit {Deinococcus radiodurans}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

SCOP Domain Coordinates for d1sm12_:

Click to download the PDB-style file with coordinates for d1sm12_.
(The format of our PDB-style files is described here.)

Timeline for d1sm12_: