Lineage for d1sl5a_ (1sl5 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514330Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 514331Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 514332Family d.169.1.1: C-type lectin domain [56437] (24 proteins)
    Pfam 00059
  6. 514345Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species)
  7. 514346Species Human (Homo sapiens) [TaxId:9606] [69856] (4 PDB entries)
  8. 514348Domain d1sl5a_: 1sl5 A: [105711]

Details for d1sl5a_

PDB Entry: 1sl5 (more details), 1.8 Å

PDB Description: crystal structure of dc-sign carbohydrate recognition domain complexed with lnfp iii (dextra l504).

SCOP Domain Sequences for d1sl5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sl5a_ d.169.1.1 (A:) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens)}
chpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnr
ftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnla
kfwickksaas

SCOP Domain Coordinates for d1sl5a_:

Click to download the PDB-style file with coordinates for d1sl5a_.
(The format of our PDB-style files is described here.)

Timeline for d1sl5a_: