Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69856] (7 PDB entries) Uniprot Q9NNX6 253-384 |
Domain d1sl5a_: 1sl5 A: [105711] complexed with ca, mg |
PDB Entry: 1sl5 (more details), 1.8 Å
SCOPe Domain Sequences for d1sl5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sl5a_ d.169.1.1 (A:) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens) [TaxId: 9606]} chpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnr ftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnla kfwickksaas
Timeline for d1sl5a_: