Lineage for d1sk3a_ (1sk3 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579367Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2579368Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2579369Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2579401Protein Peptidoglycan recognition protein I-alpha [111141] (1 species)
  7. 2579402Species Human (Homo sapiens) [TaxId:9606] [111142] (4 PDB entries)
    Uniprot Q96LB9 177-341
  8. 2579406Domain d1sk3a_: 1sk3 A: [105663]
    complexed with ni, so4

Details for d1sk3a_

PDB Entry: 1sk3 (more details), 2.8 Å

PDB Description: Crystal structure of the C-terminal peptidoglycan-binding domain of human peptidoglycan recognition protein Ialpha
PDB Compounds: (A:) Peptidoglycan recognition protein I-alpha

SCOPe Domain Sequences for d1sk3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sk3a_ d.118.1.1 (A:) Peptidoglycan recognition protein I-alpha {Human (Homo sapiens) [TaxId: 9606]}
vcpniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrn
fcdigyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqd
liqcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh

SCOPe Domain Coordinates for d1sk3a_:

Click to download the PDB-style file with coordinates for d1sk3a_.
(The format of our PDB-style files is described here.)

Timeline for d1sk3a_: