SCOP 1.71: Domain d1sjhd2: 1sjh D:122-239

Lineage for d1sjhd2 (1sjh D:122-239)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54345] (10 PDB entries)

8. Domain d1sjhd2: 1sjh D:122-239 [105653]
   Other proteins in same PDB: d1sjha1, d1sjha2, d1sjhb1, d1sjhb2, d1sjhd1
   mutant

Details for d1sjhd2

PDB Entry: 1sjh, 2.25 Å

PDB Description: hla-dr1 complexed with a 13 residue hiv capsid peptide

SCOP Domain Sequences for d1sjhd2:

Sequence; same for both SEQRES and ATOM records:

>d1sjhd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

Timeline for d1sjhd2:

• d1sjhd2 first appeared in SCOP 1.69
  
• d1sjhd2 appears in SCOP 1.73
  
• d1sjhd2 appears in the current release, SCOPe 2.08