| Class b: All beta proteins [48724] (149 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
| Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (29 PDB entries) probably orthologous to the mouse I-E group |
| Domain d1sjhb1: 1sjh B:93-190 [105650] Other proteins in same PDB: d1sjha1, d1sjha2, d1sjhb2, d1sjhd1, d1sjhd2 mutant |
PDB Entry: 1sjh (more details), 2.25 Å
SCOP Domain Sequences for d1sjhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjhb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra
Timeline for d1sjhb1:
View in 3DDomains from other chains: (mouse over for more information) d1sjha1, d1sjha2, d1sjhd1, d1sjhd2 |