SCOPe 2.01: Domain d1sjdb2: 1sjd B:1-125

Lineage for d1sjdb2 (1sjd B:1-125)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein N-acylamino acid racemase [110937] (4 species)

7. Species Amycolatopsis sp. [TaxId:37632] [110938] (4 PDB entries)
   Uniprot Q44244; similar activity to a remotely related O-succinylbenzoate synthase from E. coli

8. Domain d1sjdb2: 1sjd B:1-125 [105635]
   Other proteins in same PDB: d1sjda1, d1sjdb1, d1sjdc1, d1sjdd1
   complexed with npg

Details for d1sjdb2

PDB Entry: 1sjd, 1.87 Å

PDB Description: x-ray structure of o-succinylbenzoate synthase complexed with n-succinyl phenylglycine

PDB Compounds: (B:) N-acylamino acid racemase

SCOPe Domain Sequences for d1sjdb2:

Sequence; same for both SEQRES and ATOM records:

>d1sjdb2 d.54.1.1 (B:1-125) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

Timeline for d1sjdb2:

• d1sjdb2 first appeared in SCOP 1.69
  
• d1sjdb2 appears in SCOP 1.75
  
• d1sjdb2 appears in SCOPe 2.02
  
• d1sjdb2 appears in the current release, SCOPe 2.08