Lineage for d1sj2b2 (1sj2 B:436-740)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333593Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 2333594Protein Catalase-peroxidase KatG [74754] (6 species)
    only the N-terminal CCP-like domain binds heme
  7. 2333796Species Mycobacterium tuberculosis [TaxId:1773] [109941] (1 PDB entry)
    Uniprot Q08129
  8. 2333800Domain d1sj2b2: 1sj2 B:436-740 [105600]
    complexed with gol, hem

Details for d1sj2b2

PDB Entry: 1sj2 (more details), 2.41 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis catalase-peroxidase
PDB Compounds: (B:) peroxidase/catalase t

SCOPe Domain Sequences for d1sj2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sj2b2 a.93.1.3 (B:436-740) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]}
llwqdpvpavshdlvgeaeiaslksqirasgltvsqlvstawaaassfrgsdkrggangg
rirlqpqvgwevndpdgdlrkvirtleeiqesfnsaapgnikvsfadlvvlggcaaieka
akaaghnitvpftpgrtdasqeqtdvesfavlepkadgfrnylgkgnplpaeymlldkan
lltlsapemtvlvgglrvlganykrlplgvfteasesltndffvnlldmgitwepspadd
gtyqgkdgsgkvkwtgsrvdlvfgsnselralvevygaddaqpkfvqdfvaawdkvmnld
rfdvr

SCOPe Domain Coordinates for d1sj2b2:

Click to download the PDB-style file with coordinates for d1sj2b2.
(The format of our PDB-style files is described here.)

Timeline for d1sj2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sj2b1