SCOPe 2.07: Domain d1shh.2: 1shh D:,E:

Lineage for d1shh.2 (1shh D:,E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (171 PDB entries)
   Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620

8. Domain d1shh.2: 1shh D:,E: [105553]
   complexed with 0g6, nag

Details for d1shh.2

PDB Entry: 1shh, 1.55 Å

PDB Description: slow form of thrombin bound with ppack

PDB Compounds: (D:) thrombin, (E:) thrombin

SCOPe Domain Sequences for d1shh.2:

Sequence; same for both SEQRES and ATOM records:

>g1shh.2 b.47.1.2 (D:,E:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
adcglrplfekksledkterellesyidgXivegsdaeigmspwqvmlfrkspqellcga
slisdrwvltaahcllyppwdknftendllvrigkhsrtryeaniekismlekiyihpry
nwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwta
nvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv
mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf

Timeline for d1shh.2:

• d1shh.2 first appeared in SCOP 1.69
  
• d1shh.2 appears in SCOPe 2.06
  
• d1shh.2 appears in the current release, SCOPe 2.08