Lineage for d1sfyc_ (1sfy C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 459807Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 459934Protein Legume lectin [49904] (23 species)
  7. 459978Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (8 PDB entries)
  8. 459989Domain d1sfyc_: 1sfy C: [105509]

Details for d1sfyc_

PDB Entry: 1sfy (more details), 2.55 Å

PDB Description: crystal structure of recombinant erythrina corallodandron lectin

SCOP Domain Sequences for d1sfyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfyc_ b.29.1.1 (C:) Legume lectin {Coral tree (Erythrina corallodendron)}
vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe

SCOP Domain Coordinates for d1sfyc_:

Click to download the PDB-style file with coordinates for d1sfyc_.
(The format of our PDB-style files is described here.)

Timeline for d1sfyc_: