Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein Legume lectin [49904] (23 species) |
Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (8 PDB entries) Uniprot P16404 |
Domain d1sfyc_: 1sfy C: [105509] complexed with ca, mn |
PDB Entry: 1sfy (more details), 2.55 Å
SCOPe Domain Sequences for d1sfyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfyc_ b.29.1.1 (C:) Legume lectin {Coral tree (Erythrina corallodendron) [TaxId: 3843]} vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe
Timeline for d1sfyc_: