Lineage for d1sfyc_ (1sfy C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778531Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (8 PDB entries)
    Uniprot P16404
  8. 2778540Domain d1sfyc_: 1sfy C: [105509]
    complexed with ca, mn

Details for d1sfyc_

PDB Entry: 1sfy (more details), 2.55 Å

PDB Description: crystal structure of recombinant erythrina corallodandron lectin
PDB Compounds: (C:) lectin

SCOPe Domain Sequences for d1sfyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfyc_ b.29.1.1 (C:) Legume lectin {Coral tree (Erythrina corallodendron) [TaxId: 3843]}
vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe

SCOPe Domain Coordinates for d1sfyc_:

Click to download the PDB-style file with coordinates for d1sfyc_.
(The format of our PDB-style files is described here.)

Timeline for d1sfyc_: