SCOPe 2.07: Domain d1s8fb1: 1s8f B:4001-4173

Lineage for d1s8fb1 (1s8f B:4001-4173)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab9a [110537] (3 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [110538] (1 PDB entry)
   Uniprot P24408

8. Domain d1s8fb1: 1s8f B:4001-4173 [105371]
   Other proteins in same PDB: d1s8fb2
   complexed with bez, cl, gdp, mg, sr

Details for d1s8fb1

PDB Entry: 1s8f, 1.77 Å

PDB Description: Crystal structure of Rab9 complexed to GDP reveals a dimer with an active conformation of switch II

PDB Compounds: (B:) Ras-related protein Rab-9A

SCOPe Domain Sequences for d1s8fb1:

Sequence, based on SEQRES records:

>d1s8fb1 c.37.1.8 (B:4001-4173) Rab9a {Dog (Canis familiaris) [TaxId: 9615]}
magksslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqi
wdtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfv
ilgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvl

Sequence, based on observed residues (ATOM records):

>d1s8fb1 c.37.1.8 (B:4001-4173) Rab9a {Dog (Canis familiaris) [TaxId: 9615]}
magksslfkvillgdggvgksslmnryvtnkfdlfhtigveflnkdlevdghfvtmqiwd
tagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvil
gnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvl

Timeline for d1s8fb1:

• d1s8fb1 first appeared in SCOP 1.69, called d1s8fb_
  
• d1s8fb1 appears in SCOPe 2.06
  
• d1s8fb1 appears in the current release, SCOPe 2.08