SCOPe 2.05: Domain d1s8fb_: 1s8f B:

Lineage for d1s8fb_ (1s8f B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab9a [110537] (3 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [110538] (1 PDB entry)
   Uniprot P24408

8. Domain d1s8fb_: 1s8f B: [105371]
   complexed with bez, cl, gdp, mg, sr

Details for d1s8fb_

PDB Entry: 1s8f, 1.77 Å

PDB Description: Crystal structure of Rab9 complexed to GDP reveals a dimer with an active conformation of switch II

PDB Compounds: (B:) Ras-related protein Rab-9A

SCOPe Domain Sequences for d1s8fb_:

Sequence, based on SEQRES records:

>d1s8fb_ c.37.1.8 (B:) Rab9a {Dog (Canis familiaris) [TaxId: 9615]}
gamagksslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtm
qiwdtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfp
fvilgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvl

Sequence, based on observed residues (ATOM records):

>d1s8fb_ c.37.1.8 (B:) Rab9a {Dog (Canis familiaris) [TaxId: 9615]}
gamagksslfkvillgdggvgksslmnryvtnkfdlfhtigveflnkdlevdghfvtmqi
wdtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfv
ilgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvl

Timeline for d1s8fb_:

• d1s8fb_ first appeared in SCOP 1.69
  
• d1s8fb_ appears in SCOPe 2.04
  
• d1s8fb_ is called d1s8fb1 in SCOPe 2.06
  
• d1s8fb_ appears in the current release, SCOPe 2.08, called d1s8fb1