SCOP 1.69: Domain d1s8fa_: 1s8f A:

Lineage for d1s8fa_ (1s8f A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (43 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab9a [110537] (2 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [110538] (1 PDB entry)

8. Domain d1s8fa_: 1s8f A: [105370]

Details for d1s8fa_

PDB Entry: 1s8f, 1.77 Å

PDB Description: Crystal structure of Rab9 complexed to GDP reveals a dimer with an active conformation of switch II

SCOP Domain Sequences for d1s8fa_:

Sequence, based on SEQRES records:

>d1s8fa_ c.37.1.8 (A:) Rab9a {Dog (Canis familiaris)}
sslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqiwdta
gqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvilgn
kidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvla

Sequence, based on observed residues (ATOM records):

>d1s8fa_ c.37.1.8 (A:) Rab9a {Dog (Canis familiaris)}
sslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqiwdta
gqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvpesfpfvilgnki
diserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvla

Timeline for d1s8fa_:

• d1s8fa_ is new in SCOP 1.69
  
• d1s8fa_ appears in SCOP 1.71
  
• d1s8fa_ appears in the current release, SCOPe 2.08