Lineage for d1s8fa_ (1s8f A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867541Protein Rab9a [110537] (3 species)
  7. 2867542Species Dog (Canis familiaris) [TaxId:9615] [110538] (1 PDB entry)
    Uniprot P24408
  8. 2867543Domain d1s8fa_: 1s8f A: [105370]
    Other proteins in same PDB: d1s8fb2
    complexed with bez, cl, gdp, mg, sr

Details for d1s8fa_

PDB Entry: 1s8f (more details), 1.77 Å

PDB Description: Crystal structure of Rab9 complexed to GDP reveals a dimer with an active conformation of switch II
PDB Compounds: (A:) Ras-related protein Rab-9A

SCOPe Domain Sequences for d1s8fa_:

Sequence, based on SEQRES records: (download)

>d1s8fa_ c.37.1.8 (A:) Rab9a {Dog (Canis familiaris) [TaxId: 9615]}
sslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqiwdta
gqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvilgn
kidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvla

Sequence, based on observed residues (ATOM records): (download)

>d1s8fa_ c.37.1.8 (A:) Rab9a {Dog (Canis familiaris) [TaxId: 9615]}
sslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqiwdta
gqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvpesfpfvilgnki
diserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvla

SCOPe Domain Coordinates for d1s8fa_:

Click to download the PDB-style file with coordinates for d1s8fa_.
(The format of our PDB-style files is described here.)

Timeline for d1s8fa_: