SCOPe 2.07: Domain d1s7hb_: 1s7h B:

Lineage for d1s7hb_ (1s7h B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families)

5. Family d.58.48.2: Putative thiamin/HMP-binding protein YkoF [110987] (1 protein)
   duplication: one subunit consists of two domains assembled as in the MHT1178-like dimer

6. Protein Putative thiamin/HMP-binding protein YkoF [110988] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110989] (3 PDB entries)
   Uniprot O34911

8. Domain d1s7hb_: 1s7h B: [105350]
   Structural genomics target

Details for d1s7hb_

PDB Entry: 1s7h, 2.2 Å

PDB Description: Structural Genomics, 2.2A crystal structure of protein YKOF from Bacillus subtilis

PDB Compounds: (B:) ykoF

SCOPe Domain Sequences for d1s7hb_:

Sequence, based on SEQRES records:

>d1s7hb_ d.58.48.2 (B:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnepd
ymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnls
ansps

Sequence, based on observed residues (ATOM records):

>d1s7hb_ d.58.48.2 (B:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtykrvnedavrglkaeapcqfalypmnepdymgli
meavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsansps

Timeline for d1s7hb_:

• d1s7hb_ first appeared in SCOP 1.69
  
• d1s7hb_ appears in SCOPe 2.06
  
• d1s7hb_ appears in the current release, SCOPe 2.08