Lineage for d1s7da_ (1s7d A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467811Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 467812Superfamily b.60.1: Lipocalins [50814] (5 families) (S)
    bind hydrophobic ligands in their interior
  5. 468165Family b.60.1.4: Hypothetical protein YodA [101863] (1 protein)
    bacterial metal-binding, lipocalin-like protein
  6. 468166Protein Hypothetical protein YodA [101864] (1 species)
  7. 468167Species Escherichia coli [TaxId:562] [101865] (5 PDB entries)
  8. 468171Domain d1s7da_: 1s7d A: [105348]
    Structural genomics target

Details for d1s7da_

PDB Entry: 1s7d (more details), 2.17 Å

PDB Description: Crystal structure of refined tetragonal crystal of YodA from Escherichia coli

SCOP Domain Sequences for d1s7da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7da_ b.60.1.4 (A:) Hypothetical protein YodA {Escherichia coli}
gkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktkt
faeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylf
eckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseev
veemmsh

SCOP Domain Coordinates for d1s7da_:

Click to download the PDB-style file with coordinates for d1s7da_.
(The format of our PDB-style files is described here.)

Timeline for d1s7da_: