Lineage for d1s7da_ (1s7d A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805489Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins)
    bacterial metal-binding, lipocalin-like protein
    automatically mapped to Pfam PF09223
  6. 2805490Protein Hypothetical protein YodA [101864] (3 species)
  7. 2805493Species Escherichia coli [TaxId:562] [101865] (6 PDB entries)
    Uniprot P76344
  8. 2805497Domain d1s7da_: 1s7d A: [105348]
    Structural genomics target
    complexed with zn

Details for d1s7da_

PDB Entry: 1s7d (more details), 2.17 Å

PDB Description: Crystal structure of refined tetragonal crystal of YodA from Escherichia coli
PDB Compounds: (A:) Metal-binding protein yodA

SCOPe Domain Sequences for d1s7da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7da_ b.60.1.4 (A:) Hypothetical protein YodA {Escherichia coli [TaxId: 562]}
gkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktkt
faeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylf
eckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseev
veemmsh

SCOPe Domain Coordinates for d1s7da_:

Click to download the PDB-style file with coordinates for d1s7da_.
(The format of our PDB-style files is described here.)

Timeline for d1s7da_: