SCOPe 2.02: Domain d1s63b_: 1s63 B:

Lineage for d1s63b_ (1s63 B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69090] (20 PDB entries)
   Uniprot P49356

8. Domain d1s63b_: 1s63 B: [105286]
   Other proteins in same PDB: d1s63a_
   complexed with 778, fpp, suc, zn

Details for d1s63b_

PDB Entry: 1s63, 1.9 Å

PDB Description: human protein farnesyltransferase complexed with l-778,123 and fpp

PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOPe Domain Sequences for d1s63b_:

Sequence; same for both SEQRES and ATOM records:

>d1s63b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq
rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq
speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh
vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc
glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra
lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaq
hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe

Timeline for d1s63b_:

• d1s63b_ first appeared in SCOP 1.69
  
• d1s63b_ appears in SCOPe 2.01
  
• d1s63b_ appears in SCOPe 2.03
  
• d1s63b_ appears in the current release, SCOPe 2.08