Lineage for d1s5kb_ (1s5k B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533236Protein Aminoglycoside N-acetyltransferase AAC(6')-IY [111098] (2 species)
  7. 2533240Species Salmonella enteritidis [TaxId:149539] [111099] (3 PDB entries)
    Uniprot Q9R381
  8. 2533244Domain d1s5kb_: 1s5k B: [105277]
    Other proteins in same PDB: d1s5ka2
    complexed with coa, so4

Details for d1s5kb_

PDB Entry: 1s5k (more details), 2.4 Å

PDB Description: Aminoglycoside N-Acetyltransferase AAC(6')-Iy in Complex with CoA and N-terminal His(6)-tag (crystal form 1)
PDB Compounds: (B:) aminoglycoside 6'-N-acetyltransferase

SCOPe Domain Sequences for d1s5kb_:

Sequence, based on SEQRES records: (download)

>d1s5kb_ d.108.1.1 (B:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]}
dirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgvaigfadas
irhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtspent
isqkvhqalgfeetervifyrkrc

Sequence, based on observed residues (ATOM records): (download)

>d1s5kb_ d.108.1.1 (B:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]}
dirqmnkthlehwrglrkqladgeeilqadhlasfiamadgvaigfadasirhdyvngcd
sspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtspentisqkvhqalg
feetervifyrkrc

SCOPe Domain Coordinates for d1s5kb_:

Click to download the PDB-style file with coordinates for d1s5kb_.
(The format of our PDB-style files is described here.)

Timeline for d1s5kb_: