SCOP 1.71: Domain d1s4ya_: 1s4y A:

Lineage for d1s4ya_ (1s4y A:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (3 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins)

6. Protein Type II activin receptor [57357] (3 species)

7. Species Mouse (Mus musculus), isoform IIB [TaxId:10090] [111406] (1 PDB entry)

8. Domain d1s4ya_: 1s4y A: [105256]
   Other proteins in same PDB: d1s4yb_, d1s4yd_

Details for d1s4ya_

PDB Entry: 1s4y, 2.3 Å

PDB Description: Crystal structure of the activin/actrIIb extracellular domain

SCOP Domain Sequences for d1s4ya_:

Sequence; same for both SEQRES and ATOM records:

>d1s4ya_ g.7.1.3 (A:) Type II activin receptor {Mouse (Mus musculus), isoform IIB}
reciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfncyd
rqecvateenpqvyfcccegnfcnerfthlp

Timeline for d1s4ya_:

• d1s4ya_ first appeared in SCOP 1.69
  
• d1s4ya_ appears in SCOP 1.73
  
• d1s4ya_ appears in the current release, SCOPe 2.08