Lineage for d1s4ya_ (1s4y A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032361Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 3032417Protein Type II activin receptor [57357] (3 species)
  7. 3032424Species Mouse (Mus musculus), isoform IIB [TaxId:10090] [111406] (3 PDB entries)
    Uniprot P27040 23-120; 100% sequence identity to the rat domain of the same type IIb (90154)
  8. 3032426Domain d1s4ya_: 1s4y A: [105256]
    Other proteins in same PDB: d1s4yb_, d1s4yd_
    Structural genomics target

Details for d1s4ya_

PDB Entry: 1s4y (more details), 2.3 Å

PDB Description: Crystal structure of the activin/actrIIb extracellular domain
PDB Compounds: (A:) Activin receptor type IIB precursor

SCOPe Domain Sequences for d1s4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4ya_ g.7.1.3 (A:) Type II activin receptor {Mouse (Mus musculus), isoform IIB [TaxId: 10090]}
reciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfncyd
rqecvateenpqvyfcccegnfcnerfthlp

SCOPe Domain Coordinates for d1s4ya_:

Click to download the PDB-style file with coordinates for d1s4ya_.
(The format of our PDB-style files is described here.)

Timeline for d1s4ya_: