![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
![]() | Protein Type II activin receptor [57357] (3 species) |
![]() | Species Mouse (Mus musculus), isoform IIB [TaxId:10090] [111406] (3 PDB entries) Uniprot P27040 23-120; 100% sequence identity to the rat domain of the same type IIb (90154) |
![]() | Domain d1s4ya_: 1s4y A: [105256] Other proteins in same PDB: d1s4yb_, d1s4yd_ Structural genomics target |
PDB Entry: 1s4y (more details), 2.3 Å
SCOPe Domain Sequences for d1s4ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s4ya_ g.7.1.3 (A:) Type II activin receptor {Mouse (Mus musculus), isoform IIB [TaxId: 10090]} reciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfncyd rqecvateenpqvyfcccegnfcnerfthlp
Timeline for d1s4ya_: