Lineage for d1s28c_ (1s28 C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 615745Fold d.198: Secretion chaperone-like [69634] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 615746Superfamily d.198.1: Type III secretory system chaperone [69635] (1 family) (S)
  5. 615747Family d.198.1.1: Type III secretory system chaperone [69636] (7 proteins)
    the family sequences are very divergent
  6. 615748Protein AvrPphF ORF1, chaperone of AvrPphF ORF2 [110792] (1 species)
  7. 615749Species Pseudomonas syringae pv. phaseolicola [TaxId:319] [110793] (1 PDB entry)
  8. 615752Domain d1s28c_: 1s28 C: [105225]

Details for d1s28c_

PDB Entry: 1s28 (more details), 3 Å

PDB Description: crystal structure of avrpphf orf1, the chaperone for the type iii effector avrpphf orf2 from p. syringae

SCOP Domain Sequences for d1s28c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s28c_ d.198.1.1 (C:) AvrPphF ORF1, chaperone of AvrPphF ORF2 {Pseudomonas syringae pv. phaseolicola}
gamknsfdrlidglakdygmpgfpekkhehevycfefkevsiriyqdkfkwvyflsdigv
idnldsnacqsllrlnefnlrtpfftvglnekkdgvvhtripllnldnvemrrvfealln
lsgevkktfg

SCOP Domain Coordinates for d1s28c_:

Click to download the PDB-style file with coordinates for d1s28c_.
(The format of our PDB-style files is described here.)

Timeline for d1s28c_: