SCOP 1.69: Domain d1s28c_: 1s28 C:

Lineage for d1s28c_ (1s28 C:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.198: Secretion chaperone-like [69634] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.1: Type III secretory system chaperone [69635] (1 family)

5. Family d.198.1.1: Type III secretory system chaperone [69636] (7 proteins)
   the family sequences are very divergent

6. Protein AvrPphF ORF1, chaperone of AvrPphF ORF2 [110792] (1 species)

7. Species Pseudomonas syringae pv. phaseolicola [TaxId:319] [110793] (1 PDB entry)

8. Domain d1s28c_: 1s28 C: [105225]

Details for d1s28c_

PDB Entry: 1s28, 3 Å

PDB Description: crystal structure of avrpphf orf1, the chaperone for the type iii effector avrpphf orf2 from p. syringae

SCOP Domain Sequences for d1s28c_:

Sequence; same for both SEQRES and ATOM records:

>d1s28c_ d.198.1.1 (C:) AvrPphF ORF1, chaperone of AvrPphF ORF2 {Pseudomonas syringae pv. phaseolicola}
gamknsfdrlidglakdygmpgfpekkhehevycfefkevsiriyqdkfkwvyflsdigv
idnldsnacqsllrlnefnlrtpfftvglnekkdgvvhtripllnldnvemrrvfealln
lsgevkktfg

Timeline for d1s28c_:

• d1s28c_ is new in SCOP 1.69
  
• d1s28c_ appears in SCOP 1.71
  
• d1s28c_ appears in the current release, SCOPe 2.08, called d1s28c1