SCOPe 2.08: Domain d1s03h_: 1s03 H:

Lineage for d1s03h_ (1s03 H:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
   consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a

4. Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family)
   automatically mapped to Pfam PF00410

5. Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)

6. Protein Ribosomal protein S8 [56049] (4 species)

7. Species Escherichia coli [TaxId:562] [111186] (9 PDB entries)
   Uniprot P02361

8. Domain d1s03h_: 1s03 H: [105145]
   complexed with the spc operon mRNA
   protein/RNA complex; complexed with zn

Details for d1s03h_

PDB Entry: 1s03, 2.7 Å

PDB Description: The Structure of a Ribosomal Protein S8/spc Operon mRNA Complex

PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1s03h_:

Sequence; same for both SEQRES and ATOM records:

>d1s03h_ d.140.1.1 (H:) Ribosomal protein S8 {Escherichia coli [TaxId: 562]}
qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl
kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg
eiicyva

Timeline for d1s03h_:

• d1s03h_ first appeared in SCOP 1.69
  
• d1s03h_ appears in SCOPe 2.07