Lineage for d1s03h_ (1s03 H:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511609Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 511610Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 511611Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 511612Protein Ribosomal protein S8 [56049] (4 species)
  7. 511619Species Escherichia coli [TaxId:562] [111186] (1 PDB entry)
  8. 511621Domain d1s03h_: 1s03 H: [105145]
    complexed with the spc operon mRNA

Details for d1s03h_

PDB Entry: 1s03 (more details), 2.7 Å

PDB Description: The Structure of a Ribosomal Protein S8/spc Operon mRNA Complex

SCOP Domain Sequences for d1s03h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s03h_ d.140.1.1 (H:) Ribosomal protein S8 {Escherichia coli}
qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl
kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg
eiicyva

SCOP Domain Coordinates for d1s03h_:

Click to download the PDB-style file with coordinates for d1s03h_.
(The format of our PDB-style files is described here.)

Timeline for d1s03h_: