Lineage for d1rwja_ (1rwj A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099891Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 1099892Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 1099893Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 1099948Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species)
    contains three heme groups; deletion of one of Cyt c3 heme-binding sites
  7. 1099957Species Geobacter sulfurreducens, GSU1996 [TaxId:35554] [110039] (1 PDB entry)
    Uniprot Q74BP5
  8. 1099958Domain d1rwja_: 1rwj A: [105114]
    complexed with hem

Details for d1rwja_

PDB Entry: 1rwj (more details), 1.7 Å

PDB Description: c7-type three-heme cytochrome domain
PDB Compounds: (A:) Cytochrome c family protein

SCOPe Domain Sequences for d1rwja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwja_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Geobacter sulfurreducens, GSU1996 [TaxId: 35554]}
kgmtppktvnfkmkgvadaafshefhlgmykcnechtklfaykagakrftmadmdkgksc
gachngkdafssasdcgkchp

SCOPe Domain Coordinates for d1rwja_:

Click to download the PDB-style file with coordinates for d1rwja_.
(The format of our PDB-style files is described here.)

Timeline for d1rwja_: