Lineage for d1ruua_ (1ruu A:)

  1. Root: SCOPe 2.05
  2. 1973804Class j: Peptides [58231] (129 folds)
  3. 1974023Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 1974024Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 1974025Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 1974105Protein Peptide YY, PYY [58292] (2 species)
  7. 1974109Species Pig (Sus scrofa) [TaxId:9823] [58293] (6 PDB entries)
    Uniprot P68005
  8. 1974114Domain d1ruua_: 1ruu A: [105100]

Details for d1ruua_

PDB Entry: 1ruu (more details)

PDB Description: solution structure of porcine peptide yy (ppyy) bound to dpc micelles
PDB Compounds: (A:) Peptide YY

SCOPe Domain Sequences for d1ruua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ruua_ j.6.1.1 (A:) Peptide YY, PYY {Pig (Sus scrofa) [TaxId: 9823]}
ypakpeapgedaspeelsryyaslrhylnlvtrqry

SCOPe Domain Coordinates for d1ruua_:

Click to download the PDB-style file with coordinates for d1ruua_.
(The format of our PDB-style files is described here.)

Timeline for d1ruua_: