Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) |
Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins) |
Protein Cell-division protein FtsZ [52492] (4 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [110501] (5 PDB entries) Uniprot O08378 |
Domain d1rq2b1: 1rq2 B:8-205 [105050] Other proteins in same PDB: d1rq2a2, d1rq2b2 complexed with cit |
PDB Entry: 1rq2 (more details), 1.86 Å
SCOPe Domain Sequences for d1rq2b1:
Sequence, based on SEQRES records: (download)
>d1rq2b1 c.32.1.1 (B:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl lngvqgitdlittpglin
>d1rq2b1 c.32.1.1 (B:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgadpevgrk aaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfsfeg krrsnqaengiaalrescdtlivipndrllqmgvslmdafrsadevllngvqgitdlitt pglin
Timeline for d1rq2b1: