Lineage for d1rpwd1 (1rpw D:2-72)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 905282Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 905661Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)
  6. 905690Protein Multidrug binding protein QacR [68964] (1 species)
  7. 905691Species Staphylococcus aureus [TaxId:1280] [68965] (20 PDB entries)
    Uniprot P23217
  8. 905739Domain d1rpwd1: 1rpw D:2-72 [105042]
    Other proteins in same PDB: d1rpwa2, d1rpwb2, d1rpwc2, d1rpwd2
    complexed with did, so4

Details for d1rpwd1

PDB Entry: 1rpw (more details), 2.9 Å

PDB Description: crystal structure of the multidrug binding protein qacr bound to the diamidine hexamidine
PDB Compounds: (D:) Transcriptional regulator qacR

SCOPe Domain Sequences for d1rpwd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpwd1 a.4.1.9 (D:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOPe Domain Coordinates for d1rpwd1:

Click to download the PDB-style file with coordinates for d1rpwd1.
(The format of our PDB-style files is described here.)

Timeline for d1rpwd1: