Lineage for d1ro5a1 (1ro5 A:1-197)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968867Family d.108.1.3: Autoinducer synthetase [75508] (2 proteins)
    Pfam PF00765
  6. 2968872Protein Autoinducer synthesis protein LasI [111102] (1 species)
  7. 2968873Species Pseudomonas aeruginosa [TaxId:287] [111103] (1 PDB entry)
    Uniprot P33883
  8. 2968874Domain d1ro5a1: 1ro5 A:1-197 [105023]
    Other proteins in same PDB: d1ro5a2
    complexed with so4, zn

Details for d1ro5a1

PDB Entry: 1ro5 (more details), 2.3 Å

PDB Description: crystal structure of the ahl synthase lasi
PDB Compounds: (A:) Autoinducer synthesis protein lasI

SCOPe Domain Sequences for d1ro5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ro5a1 d.108.1.3 (A:1-197) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]}
mivqigrreefdkkllgemhklraqvfkerkgwdvsvidemeidgydalspyymliqedg
qvfgcwrildttgpymlkntfpellhgkeapcsphiwelsrfainsgqkgslgfsdctle
amralaryslqndiqtlvtvttvgvekmmiragldvsrfgphlkigieravalrielnak
tqialyggvlveqr

SCOPe Domain Coordinates for d1ro5a1:

Click to download the PDB-style file with coordinates for d1ro5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ro5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ro5a2