Lineage for d1rj2g2 (1rj2 G:819-950)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467364Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 467365Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 467366Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (24 protein domains)
  6. 467381Protein Dbl's big sister, Dbs [74989] (1 species)
  7. 467382Species Mouse (Mus musculus) [TaxId:10090] [74990] (4 PDB entries)
  8. 467393Domain d1rj2g2: 1rj2 G:819-950 [104959]
    Other proteins in same PDB: d1rj2a1, d1rj2d1, d1rj2g1, d1rj2j1

Details for d1rj2g2

PDB Entry: 1rj2 (more details), 3 Å

PDB Description: Crystal structure of the DH/PH fragment of Dbs without bound GTPase

SCOP Domain Sequences for d1rj2g2:

Sequence, based on SEQRES records: (download)

>d1rj2g2 b.55.1.1 (G:819-950) Dbl's big sister, Dbs {Mouse (Mus musculus)}
tgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhlflhekavlfckkree
ngegyekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawv
neirkvltsqlq

Sequence, based on observed residues (ATOM records): (download)

>d1rj2g2 b.55.1.1 (G:819-950) Dbl's big sister, Dbs {Mouse (Mus musculus)}
tgydgnlgdlgkllmqgsfsvwtdkpmqrhlflhekavlfckkryekapsysykqslnmt
avgitenvkgdtkkfeiwynareevyiiqaptpeikaawvneirkvltsqlq

SCOP Domain Coordinates for d1rj2g2:

Click to download the PDB-style file with coordinates for d1rj2g2.
(The format of our PDB-style files is described here.)

Timeline for d1rj2g2: