SCOP 1.69: Domain d1re3f1: 1re3 F:142-393

Lineage for d1re3f1 (1re3 F:142-393)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family)

5. Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)

6. Protein Fibrinogen C-terminal domains [56498] (7 species)

7. Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (19 PDB entries)

8. Domain d1re3f1: 1re3 F:142-393 [104899]
   Other proteins in same PDB: d1re3a_, d1re3b2, d1re3c2, d1re3d_, d1re3e2, d1re3f2

Details for d1re3f1

PDB Entry: 1re3, 2.45 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1re3f1:

Sequence; same for both SEQRES and ATOM records:

>d1re3f1 d.171.1.1 (F:142-393) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrlt

Timeline for d1re3f1:

• d1re3f1 is new in SCOP 1.69
  
• d1re3f1 appears in SCOP 1.71
  
• d1re3f1 appears in the current release, SCOPe 2.08