Lineage for d1re3b2 (1re3 B:165-199)

  1. Root: SCOP 1.69
  2. 525081Class h: Coiled coil proteins [57942] (6 folds)
  3. 525082Fold h.1: Parallel coiled-coil [57943] (28 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 525512Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 525513Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 525561Protein Fibrinogen beta chain [88892] (4 species)
  7. 525570Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
  8. 525573Domain d1re3b2: 1re3 B:165-199 [104893]
    Other proteins in same PDB: d1re3a_, d1re3b1, d1re3c1, d1re3c2, d1re3d_, d1re3e1, d1re3f1, d1re3f2

Details for d1re3b2

PDB Entry: 1re3 (more details), 2.45 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1re3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re3b2 h.1.8.1 (B:165-199) Fibrinogen beta chain {Human (Homo sapiens)}
lrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOP Domain Coordinates for d1re3b2:

Click to download the PDB-style file with coordinates for d1re3b2.
(The format of our PDB-style files is described here.)

Timeline for d1re3b2:

525573
d1re3b2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1re3b1