Lineage for d1rcqa2 (1rcq A:8-233)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1338710Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 1338711Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 1338712Protein Alanine racemase [51421] (3 species)
  7. 1338730Species Pseudomonas aeruginosa [TaxId:287] [110345] (1 PDB entry)
    Uniprot Q9HTQ2
  8. 1338731Domain d1rcqa2: 1rcq A:8-233 [104883]
    Other proteins in same PDB: d1rcqa1
    complexed with dly, plp

Details for d1rcqa2

PDB Entry: 1rcq (more details), 1.45 Å

PDB Description: The 1.45 A crystal structure of alanine racemase from a pathogenic bacterium, Pseudomonas aeruginosa, contains both internal and external aldimine forms
PDB Compounds: (A:) catabolic alanine racemase DadX

SCOPe Domain Sequences for d1rcqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcqa2 c.1.6.1 (A:8-233) Alanine racemase {Pseudomonas aeruginosa [TaxId: 287]}
idlqalrhnyrlareatgaralavikadayghgavrcaealaaeadgfavacieeglelr
eagirqpilllegffeaselelivahdfwcvvhcawqleaieraslarplnvwlkmdsgm
hrvgffpedfraaherlrasgkvakivmmshfsradeldcprteeqlaafsaasqglege
islrnspavlgwpkvpsdwvrpgillygatpferahpladrlrpvm

SCOPe Domain Coordinates for d1rcqa2:

Click to download the PDB-style file with coordinates for d1rcqa2.
(The format of our PDB-style files is described here.)

Timeline for d1rcqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rcqa1