Lineage for d1rcqa2 (1rcq A:8-233)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473860Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 473861Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 473862Protein Alanine racemase [51421] (3 species)
  7. 473880Species Pseudomonas aeruginosa [TaxId:287] [110345] (1 PDB entry)
  8. 473881Domain d1rcqa2: 1rcq A:8-233 [104883]
    Other proteins in same PDB: d1rcqa1

Details for d1rcqa2

PDB Entry: 1rcq (more details), 1.45 Å

PDB Description: The 1.45 A crystal structure of alanine racemase from a pathogenic bacterium, Pseudomonas aeruginosa, contains both internal and external aldimine forms

SCOP Domain Sequences for d1rcqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcqa2 c.1.6.1 (A:8-233) Alanine racemase {Pseudomonas aeruginosa}
idlqalrhnyrlareatgaralavikadayghgavrcaealaaeadgfavacieeglelr
eagirqpilllegffeaselelivahdfwcvvhcawqleaieraslarplnvwlkmdsgm
hrvgffpedfraaherlrasgkvakivmmshfsradeldcprteeqlaafsaasqglege
islrnspavlgwpkvpsdwvrpgillygatpferahpladrlrpvm

SCOP Domain Coordinates for d1rcqa2:

Click to download the PDB-style file with coordinates for d1rcqa2.
(The format of our PDB-style files is described here.)

Timeline for d1rcqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rcqa1