![]() | Class j: Peptides [58231] (116 folds) |
![]() | Fold j.35: Transmembrane helical fragments [58517] (1 superfamily) |
![]() | Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) ![]() |
![]() | Family j.35.1.1: Transmembrane helical fragments [58519] (28 proteins) the member of this family may be not related |
![]() | Protein Membrane anchor domain of the nonstructural protein 5a (NS5a) [111509] (1 species) |
![]() | Species Hepatitis C virus, HCV [TaxId:11103] [111510] (5 PDB entries) |
![]() | Domain d1r7ga_: 1r7g A: [104835] |
PDB Entry: 1r7g (more details)
SCOP Domain Sequences for d1r7ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r7ga_ j.35.1.1 (A:) Membrane anchor domain of the nonstructural protein 5a (NS5a) {Hepatitis C virus, HCV} sgswlrdiwdwicevlsdfktwlkaklmpql
Timeline for d1r7ga_: