Lineage for d1r7ga_ (1r7g A:)

  1. Root: SCOP 1.69
  2. 528313Class j: Peptides [58231] (116 folds)
  3. 529025Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 529026Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 529027Family j.35.1.1: Transmembrane helical fragments [58519] (28 proteins)
    the member of this family may be not related
  6. 529089Protein Membrane anchor domain of the nonstructural protein 5a (NS5a) [111509] (1 species)
  7. 529090Species Hepatitis C virus, HCV [TaxId:11103] [111510] (5 PDB entries)
  8. 529095Domain d1r7ga_: 1r7g A: [104835]

Details for d1r7ga_

PDB Entry: 1r7g (more details)

PDB Description: nmr structure of the membrane anchor domain (1-31) of the nonstructural protein 5a (ns5a) of hepatitis c virus (minimized average structure, sample in 100mm dpc)

SCOP Domain Sequences for d1r7ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7ga_ j.35.1.1 (A:) Membrane anchor domain of the nonstructural protein 5a (NS5a) {Hepatitis C virus, HCV}
sgswlrdiwdwicevlsdfktwlkaklmpql

SCOP Domain Coordinates for d1r7ga_:

Click to download the PDB-style file with coordinates for d1r7ga_.
(The format of our PDB-style files is described here.)

Timeline for d1r7ga_: