SCOP 1.69: Domain d1r44e_: 1r44 E:

Lineage for d1r44e_ (1r44 E:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (4 families)
   zinc-binding motif

5. Family d.65.1.4: VanX-like (Pfam 01427) [111022] (1 protein)

6. Protein D-Ala-D-Ala dipeptidase VanX [111023] (1 species)

7. Species Enterococcus faecium [TaxId:1352] [111024] (1 PDB entry)

8. Domain d1r44e_: 1r44 E: [104791]

Details for d1r44e_

PDB Entry: 1r44, 2.25 Å

PDB Description: crystal structure of vanx

SCOP Domain Sequences for d1r44e_:

Sequence; same for both SEQRES and ATOM records:

>d1r44e_ d.65.1.4 (E:) D-Ala-D-Ala dipeptidase VanX {Enterococcus faecium}
meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
ewwhyvlrdepypnsyfdfpvk

Timeline for d1r44e_:

• d1r44e_ is new in SCOP 1.69
  
• d1r44e_ appears in SCOP 1.71
  
• d1r44e_ appears in the current release, SCOPe 2.08