PDB entry 1r44

View 1r44 on RCSB PDB site
Description: crystal structure of vanx
Deposited on 2003-10-03, released 2004-06-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-15, with a file datestamp of 2004-06-15.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.254
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1r44a_
  • Chain 'B':
    Domains in SCOP 1.69: d1r44b_
  • Chain 'C':
    Domains in SCOP 1.69: d1r44c_
  • Chain 'D':
    Domains in SCOP 1.69: d1r44d_
  • Chain 'E':
    Domains in SCOP 1.69: d1r44e_
  • Chain 'F':
    Domains in SCOP 1.69: d1r44f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r44A (A:)
    meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
    gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
    aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
    ewwhyvlrdepypnsyfdfpvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r44B (B:)
    meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
    gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
    aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
    ewwhyvlrdepypnsyfdfpvk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r44C (C:)
    meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
    gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
    aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
    ewwhyvlrdepypnsyfdfpvk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r44D (D:)
    meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
    gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
    aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
    ewwhyvlrdepypnsyfdfpvk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r44E (E:)
    meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
    gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
    aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
    ewwhyvlrdepypnsyfdfpvk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r44F (F:)
    meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
    gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
    aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
    ewwhyvlrdepypnsyfdfpvk