SCOP 1.75: Domain d1r0bi1: 1r0b I:1-100

Lineage for d1r0bi1 (1r0b I:1-100)

Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family)
Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
Protein Aspartate carbamoyltransferase [54895] (2 species)
Species Escherichia coli [TaxId:562] [54896] (46 PDB entries)
Uniprot P00478

Domain d1r0bi1: 1r0b I:1-100 [104699]
Other proteins in same PDB: d1r0ba1, d1r0ba2, d1r0bb1, d1r0bb2, d1r0bc1, d1r0bc2, d1r0bd1, d1r0bd2, d1r0be1, d1r0be2, d1r0bf1, d1r0bf2, d1r0bg2, d1r0bh2, d1r0bi2, d1r0bj2, d1r0bk2, d1r0bl2

Details for d1r0bi1

PDB Entry: 1r0b (more details), 2.9 Å

PDB Description: aspartate transcarbamylase (atcase) of escherichia coli: a new crystalline r state bound to pala, or to product analogues phosphate and citrate

PDB Compounds: (I:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d1r0bi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0bi1 d.58.2.1 (I:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1r0bi1:

Click to download the PDB-style file with coordinates for d1r0bi1.
(The format of our PDB-style files is described here.)

Timeline for d1r0bi1: