Lineage for d1r0bi1 (1r0b I:1-100)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504113Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 504114Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 504115Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 504118Species Escherichia coli [TaxId:562] [54896] (33 PDB entries)
  8. 504186Domain d1r0bi1: 1r0b I:1-100 [104699]
    Other proteins in same PDB: d1r0ba1, d1r0ba2, d1r0bb1, d1r0bb2, d1r0bc1, d1r0bc2, d1r0bd1, d1r0bd2, d1r0be1, d1r0be2, d1r0bf1, d1r0bf2, d1r0bg2, d1r0bh2, d1r0bi2, d1r0bj2, d1r0bk2, d1r0bl2

Details for d1r0bi1

PDB Entry: 1r0b (more details), 2.9 Å

PDB Description: Aspartate Transcarbamylase (ATCase) of Escherichia coli: A New Crystalline R State Bound to PALA, or to Product Analogues Phosphate and Citrate

SCOP Domain Sequences for d1r0bi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0bi1 d.58.2.1 (I:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1r0bi1:

Click to download the PDB-style file with coordinates for d1r0bi1.
(The format of our PDB-style files is described here.)

Timeline for d1r0bi1: