SCOP 1.71: Domain d1r0bf2: 1r0b F:151-310

Lineage for d1r0bf2 (1r0b F:151-310)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)

7. Species Escherichia coli [TaxId:562] [53674] (36 PDB entries)

8. Domain d1r0bf2: 1r0b F:151-310 [104694]
   Other proteins in same PDB: d1r0bg1, d1r0bg2, d1r0bh1, d1r0bh2, d1r0bi1, d1r0bi2, d1r0bj1, d1r0bj2, d1r0bk1, d1r0bk2, d1r0bl1, d1r0bl2
   complexed with flc, ips, zn

Details for d1r0bf2

PDB Entry: 1r0b, 2.9 Å

PDB Description: aspartate transcarbamylase (atcase) of escherichia coli: a new crystalline r state bound to pala, or to product analogues phosphate and citrate

SCOP Domain Sequences for d1r0bf2:

Sequence; same for both SEQRES and ATOM records:

>d1r0bf2 c.78.1.1 (F:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

Timeline for d1r0bf2:

• d1r0bf2 first appeared in SCOP 1.69
  
• d1r0bf2 appears in SCOP 1.73
  
• d1r0bf2 appears in the current release, SCOPe 2.08