Lineage for d1r0bl1 (1r0b L:1-100)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603439Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 603440Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 603441Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 603444Species Escherichia coli [TaxId:562] [54896] (33 PDB entries)
  8. 603515Domain d1r0bl1: 1r0b L:1-100 [104705]
    Other proteins in same PDB: d1r0ba1, d1r0ba2, d1r0bb1, d1r0bb2, d1r0bc1, d1r0bc2, d1r0bd1, d1r0bd2, d1r0be1, d1r0be2, d1r0bf1, d1r0bf2, d1r0bg2, d1r0bh2, d1r0bi2, d1r0bj2, d1r0bk2, d1r0bl2
    complexed with flc, ips, zn

Details for d1r0bl1

PDB Entry: 1r0b (more details), 2.9 Å

PDB Description: Aspartate Transcarbamylase (ATCase) of Escherichia coli: A New Crystalline R State Bound to PALA, or to Product Analogues Phosphate and Citrate

SCOP Domain Sequences for d1r0bl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0bl1 d.58.2.1 (L:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1r0bl1:

Click to download the PDB-style file with coordinates for d1r0bl1.
(The format of our PDB-style files is described here.)

Timeline for d1r0bl1: