SCOPe 2.02: Domain d1qvub2: 1qvu B:73-187

Lineage for d1qvub2 (1qvu B:73-187)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (20 PDB entries)
   Uniprot P23217

8. Domain d1qvub2: 1qvu B:73-187 [104613]
   Other proteins in same PDB: d1qvua1, d1qvub1, d1qvud1, d1qvue1
   complexed with et, prl

Details for d1qvub2

PDB Entry: 1qvu, 2.96 Å

PDB Description: Crystal structure of the multidrug binding transcriptional repressor QacR bound to two drugs: ethidium and proflavine

PDB Compounds: (B:) Transcriptional regulator qacR

SCOPe Domain Sequences for d1qvub2:

Sequence; same for both SEQRES and ATOM records:

>d1qvub2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d1qvub2:

• d1qvub2 first appeared in SCOP 1.69
  
• d1qvub2 appears in SCOPe 2.01
  
• d1qvub2 appears in SCOPe 2.03
  
• d1qvub2 appears in the current release, SCOPe 2.08