Lineage for d1q95c1 (1q95 C:1-150)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1005672Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 1005673Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 1005674Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 1005675Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)
  7. 1005683Species Escherichia coli [TaxId:562] [53674] (50 PDB entries)
    Uniprot P00479
  8. 1005804Domain d1q95c1: 1q95 C:1-150 [104569]
    Other proteins in same PDB: d1q95g1, d1q95g2, d1q95h1, d1q95h2, d1q95i1, d1q95i2, d1q95j1, d1q95j2, d1q95k1, d1q95k2, d1q95l1, d1q95l2
    complexed with pal, zn

Details for d1q95c1

PDB Entry: 1q95 (more details), 2.46 Å

PDB Description: Aspartate Transcarbamylase (ATCase) of Escherichia coli: A New Crystalline R State Bound to PALA, or to Product Analogues Phosphate and Citrate
PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d1q95c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q95c1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d1q95c1:

Click to download the PDB-style file with coordinates for d1q95c1.
(The format of our PDB-style files is described here.)

Timeline for d1q95c1: