Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins) |
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species) |
Species Escherichia coli [TaxId:562] [53674] (50 PDB entries) Uniprot P00479 |
Domain d1q95c1: 1q95 C:1-150 [104569] Other proteins in same PDB: d1q95g1, d1q95g2, d1q95h1, d1q95h2, d1q95i1, d1q95i2, d1q95j1, d1q95j2, d1q95k1, d1q95k2, d1q95l1, d1q95l2 complexed with pal, zn |
PDB Entry: 1q95 (more details), 2.46 Å
SCOPe Domain Sequences for d1q95c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q95c1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg nvpvlnagdgsnqhptqtlldlftiqetqg
Timeline for d1q95c1: